PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 250aa    MW: 29029.7 Da    PI: 7.5018
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1994genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
      Gh_A13G1994 11 KGPWTEKEDMVLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 58
                     79********************************************97 PP

2Myb_DNA-binding56.75.5e-1864109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l +++++++G++ W++Iar+++ gRt++++k++w++++
      Gh_A13G1994  64 RGKMTPQEEKLVLELHAKWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 109
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.16658IPR017930Myb domain
SuperFamilySSF466897.49E-309105IPR009057Homeodomain-like
SMARTSM007179.7E-151060IPR001005SANT/Myb domain
PfamPF002492.9E-151158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-211265IPR009057Homeodomain-like
CDDcd001671.31E-101358No hitNo description
PROSITE profilePS5129425.56859113IPR017930Myb domain
SMARTSM007174.3E-1763111IPR001005SANT/Myb domain
PfamPF002491.2E-1664108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2466111IPR009057Homeodomain-like
CDDcd001675.58E-1266109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEMVKDESCR KGPWTEKEDM VLVNFVHLFG DRRWDFIAKV SGLNRTGKSC RLRWVNYLHP  60
GLKRGKMTPQ EEKLVLELHA KWGNRWSRIA RRLPGRTDNE IKNYWRTHMR KMALEKKRST  120
SPSSSSSSTV TRVDSLPSSG TGKVSFYDTG GPKMAVFDDV KGYSMDEIWK DIDMSEGNTT  180
KLPSSENYSE QGCCNHFSCP SMASSPPWDF SWDYSLWKMD DDDEEEEEEE RKVFIATTNN  240
QLFNLFVHKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-27111114103MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-261111158157MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-261111158157MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-27111114103C-Myb DNA-Binding Domain
1msf_C4e-27111114103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6165210.0JX616521.1 Gossypium hirsutum clone NBRI_GE61253 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464122.11e-169PREDICTED: transcription factor MYB59-like
SwissprotQ9LX822e-91MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D2W9Q91e-169A0A0D2W9Q9_G
STRINGVIT_06s0004g04140.t016e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.19e-88myb domain protein 48